Pure Peptides Lab Ltd is registered in England & Wales, company number 16876166 .
Email us now:

Price range: £50.00 through £65.00
A 39-residue peptide hormone derived from the POMC precursor. The canonical reference standard for melanocortin (MC2R) and HPA-axis research.
What’s in your box
Everything researchers usually message us about, answered on the page.
Yes, every batch. Every product we supply is independently HPLC-verified by Janoshik Analytical, a Czech specialist peptide-analysis laboratory unaffiliated with us. Reported purity is consistently above 99%.
Where a Janoshik report has been issued for the current batch, the printed Certificate of Analysis is supplied with the order. Otherwise, the verification record is published on our Purity page.
Every COA carries a unique verification key you can authenticate against Janoshik’s own portal at janoshik.com – so you don’t have to take our word for it. We’re the only UK supplier writing publicly about how to read these reports: how to read a Janoshik HPLC report. ›
Use the reconstitution card on the inside of the box lid as your reference next time.
One pen lasts the number of doses shown in the protocol cards above for your selected size. When it’s empty, drop a refill cartridge into the same pen body – price for your size is in the calculator at the top.
Research use only. Procedure drawn from published cohort protocols. We do not provide medical or human-use guidance.
Lyophilised vial: stable 24+ months at 2–8°C, sealed and protected from light. Don’t freeze.
Reconstituted (after BAC water): ~30 days at 2–8°C. Don’t shake. Keep in original glass vial. Discard if cloudy or discoloured.
BAC water bottle: 30 days once opened, refrigerated.
Published research literature on ACTH 1-39 uses subcutaneous administration in the abdomen, thigh or upper arm in human pharmacokinetic and phase 2 / 3 studies. Researchers rotate sites between administrations to reduce local tissue stress.
Research use only. The route information above is drawn from published peer-reviewed literature for context. We do not provide human-use guidance, dosing protocols, or administration instructions.
Reference: Catania et al. 2004
The clean answer: follow the protocol cards above. Published research literature on ACTH 1-39 uses titration – start low, step up at fixed weekly intervals. The phase highlighted in green is where most published research cohorts settle for ongoing study.
If you’re new to this compound, start at Phase 1 (the lowest dose shown above) for the full duration of that phase, then step up to the next. The titration is what limits the GI side effects reported in the trial – don’t skip it.
If you’ve used this compound before, you already know which phase you’re at. Tap the phase tabs above to see exactly what your dose costs at your selected vial or pen size, plus how long it will last.
If your protocol is non-standard: WhatsApp us before you order. We help researchers work out custom schedules every day and will tell you which size makes most sense for the cadence you’re running. Real human reply, not a chatbot.
Research use only. The dosing described is drawn from published peer-reviewed cohort literature for context. We do not provide medical or human-use guidance. If you are evaluating this compound for human use, consult a qualified medical practitioner. Reference: Catania et al. 2004
| Compound | ACTH 1-39 |
| Research category | Other Research |
| Available sizes | 5mg |
| Pricing | From £30 |
| Format | Lyophilised powder in sealed vial |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic 39-amino-acid corticotropin (ACTH 1-39) |
| Molecular formula | C207H308N56O58S |
| Molecular weight | 4541.1 g/mol |
| CAS Registry Number | 9002-60-2 |
| PubChem CID | 16129617 |
| Number of residues | 39 |
| Amino acid sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Receptor / mechanism | MC2R (ACTH receptor) agonist. |
| Reported half-life | Reported ~10–20 minutes in human serum. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C, lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8°C, use within 14 days. |
| Clinical / regulatory status | Approved historically for research-relevant indications. |
ACTH 1-39 (Adrenocorticotropic Hormone) is a 39-amino-acid polypeptide characterised in the biochemical literature as the principal agonist at the melanocortin-2 receptor (MC2R) on the adrenal cortex. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
ACTH 1-39 is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved – do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or -20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Every batch of ACTH 1-39 we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch, it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik’s records. Reported purity is consistently above 99%.
Researchers working with ACTH 1-39 often work alongside the following compounds in the preclinical literature:
| SIZE | 5mg |
|---|---|
| Format | Pen, Vial |
Reviews
There are no reviews yet.